Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646572.1 | 3prime_partial | 255 | 13-777(+) |
Amino Acid sequence : | |||
MEKTSASSMLLFLCILVISFSWATSSSIATERLLQCLVVPSGPAIPVYTPNNSSYNSILQSKIQIVRFASSDIPKPRLIITPLHESHVQKAVICCRKHGFQMRTRSGGHDYEGLSYTTYN GIVPFVVLDLFNLQTISVDVEDGTAWVQAGATLAQVYYKIADKSSTYGFPAGICPTVGVGGHFSGGGYGTLMRKYGLSADNIVDARIVNIDGKILNKDSMGEELFWAIRGGGGASFGIVL SWKIKLVPVPPTVTV | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 27,513.470 | ||
Theoretical pI: | 8.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
Instability index: | 29.230 | ||
aromaticity | 0.094 | ||
GRAVY | 0.220 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.282 | ||
sheet | 0.192 |