Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646580.1 | 3prime_partial | 224 | 61-732(+) |
Amino Acid sequence : | |||
MAARRISTLLSRSLNPSLRLLGKNSTWSRGGISRFGTAAVVEEPITPSVQVNHNQLLINGQFVDAASGRTFPTLDPRTGEIIAHVAEADSEDVNRAVSAARKAFDEGPWPKMSAYERSRV ISRFADLLEKHSEEIAALETWDNGKPYEQALRAEIPMVVRLFRYYAGWADKIHGLTVPADGAHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALATGNTIVL | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 24,627.800 | ||
Theoretical pI: | 7.078 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 38960 | ||
Instability index: | 32.456 | ||
aromaticity | 0.080 | ||
GRAVY | -0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.241 | ||
sheet | 0.290 |