Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646584.1	internal	250	3-752(+)
Amino Acid sequence :
FNWGAAGVSTSVWRGVRLVDVLKRCGIYSRRMGASFVCFEGAENLPGGGGSKYGTSVFREYAMDPSRDIILAYMQNGELLSPDHGFPVRIIIPGFIGGRMVKWLSRIIVTPQESQSHYHF KDNRVLPSHVDAELANSEAWWYKPEYIINELNTNSVITTPSHDEILPINSATTQRPYTLRGYAYSGGGKKVTRVEVTMDGGDTWQVCELDHPEKPNKYGKYWCWCFWSLEVEVLDLLGAK RLLFVHGTRP
Physicochemical properties
Number of amino acids:		250
Molecular weight:		11,402.772
Theoretical pI:		6.907
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		34950 35075
Instability index:		28.140
aromaticity		0.144
GRAVY		-0.028
Secondary Structure Fraction
Helix		0.317
turn		0.337
sheet		0.221

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646584.1	5prime_partial	104	1-315(+)
Amino Acid sequence :
GSTGAQRECPLLCGAVYGWSMFLNDAGFTAVGWGPHSFVLKGPRISQVAEDPSMGPAFLESMRWILHVISYWLTCRTASFYPLITGSRYESSYRGSSVGEWSNG*
Physicochemical properties
Number of amino acids:		104
Molecular weight:		11,402.772
Theoretical pI:		6.907
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		34950 35075
Instability index:		28.140
aromaticity		0.144
GRAVY		-0.028
Secondary Structure Fraction
Helix		0.317
turn		0.337
sheet		0.221