Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646610.1 | complete | 205 | 3-620(+) |
Amino Acid sequence : | |||
MLAKAVANHTTLAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEF PLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYK* | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 23,337.647 | ||
Theoretical pI: | 7.728 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 26.110 | ||
aromaticity | 0.078 | ||
GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.141 | ||
sheet | 0.278 |