Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646611.1 | 3prime_partial | 228 | 1-684(+) |
Amino Acid sequence : | |||
MPKKPHVVLIPFPAQGHVHPFMQLAQLLHSQGFYITFVNTEFNHGRLLRSKGLKTLKGLTDFKFETISDGLPPSDRDATQDPIALCDSFRKDNCLKPLLELLAKLNSSSSTYSGVPPVSC IISDGAMSFAIKAAECLGIPEIQFWTASACGLLGYLQFRELVSRGITPLKDETYLSNGYLDMKLDWVPGMPNIRLKDLPSFVQTTDPNDVLFDYLKEESQNCFMANAI | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 25,376.029 | ||
Theoretical pI: | 5.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 42.420 | ||
aromaticity | 0.096 | ||
GRAVY | -0.067 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.254 | ||
sheet | 0.254 |