Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646613.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
LAMEALSERVVSLRESLQKSQTITDNMVSILGSFDHRLSALETAMRPTQIRTHSIRKAHENIDKTLKAADVIMAQFDLSRQAEAKILRGPHEDLESYLEAVDQLRSNIRFFSSNKSFKSS DGVLNHANNLLAKAILKLEEEFKNLLTSYSKPVEPDRLFDGLPNSLRPSGGSPGHPKNSSSTNHHEHSNKTLENAVYTPPTLIPPRILPLLHDLAQQMVQAGHQQQLAKIYRETRASVLE QSLRKLGVEKLSKDDV | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 28,685.211 | ||
Theoretical pI: | 8.729 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 41.586 | ||
aromaticity | 0.043 | ||
GRAVY | -0.533 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.246 | ||
sheet | 0.297 |