Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646628.1 | internal | 262 | 1-786(+) |
Amino Acid sequence : | |||
PTNVTVGQLYYIPLNSVPGEPYHQQEEIPPTSAPEPSAKSLEAIPVNHKDHFPYGWTIGALGVGLFLIFGTILICLLYKSSTCCARAPQNLAKGSDGKISHKFHILGRTSFFCASERSIR SKTGDWKPKNGESSDRHISIPTAVGTDVFDMEKPVVFTYEEILCATDCFSDSNLLGHGTYGSVYYAVLRDQEVAIKRMTATKTKEFMAEMKVLCKVHHANLVELIGYAACEEELFLIYEC AQKGSLRNHLHDPHNKGNTSLS | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 28,983.742 | ||
Theoretical pI: | 6.487 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27890 | ||
Instability index: | 43.719 | ||
aromaticity | 0.092 | ||
GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.248 | ||
sheet | 0.240 |