Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646637.1 | 3prime_partial | 238 | 84-797(+) |
Amino Acid sequence : | |||
MSVTSIPAMGLLLLCCWAAMVDAEYMKYKDPKQPLNTRIKDLMARMTLEEKIGQMVQIERSVASADVMKKYFIGSVLSGGGSVPAPRASAETWIKMVNEFQRGSLSTRLGIPMIYGIDAV HGHNNVYNATIFPHNVGLGATRDPHLLKKIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDPKIVQAMTDIIPGLQGDLPAGSRKGVPFVGGSKKVAACAKHYVGDGGTT | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 25,677.637 | ||
Theoretical pI: | 9.097 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
Instability index: | 32.468 | ||
aromaticity | 0.071 | ||
GRAVY | -0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.248 | ||
sheet | 0.252 |