Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646639.1 | 3prime_partial | 250 | 48-797(+) |
Amino Acid sequence : | |||
MERIDPSVLARGRLAVLTSHLVASDPSHAVVSRALERSTVSAQDHLVPPPGNLKGLLTIVDERTGKKYQVQVSEEGTVKATDLKKIATGRYDKGLKLYDPGYLNTAPVRSSICYIDGDEG ILRYRGYPIEELAESSSFLEVAYLLTYGNLPSQSQLADWEFAVSQHSAVPQGILDIIQSMPHDAHPMGVLVSAMSALSVFHPDANPALRGQDLYKSKQVRDKQIARILGKVPTIAAAAYL RMAGRPPVLP | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,195.845 | ||
Theoretical pI: | 7.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 21890 | ||
Instability index: | 42.140 | ||
aromaticity | 0.060 | ||
GRAVY | -0.148 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.244 | ||
sheet | 0.276 |