Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646643.1	internal	262	2-787(+)
Amino Acid sequence :
ARSSLIRGESLRVFSFKFRVRAMASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMA RGNAAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEK LKAFTAAYSELESTLSGVMLSL
Physicochemical properties
Number of amino acids:		262
Molecular weight:		28,954.678
Theoretical pI:		6.261
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		43890 43890
Instability index:		29.848
aromaticity		0.118
GRAVY		-0.072
Secondary Structure Fraction
Helix		0.328
turn		0.240
sheet		0.290