Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646647.1 | internal | 287 | 2-862(+) |
Amino Acid sequence : | |||
LIRGESLRVFSFKFRVRAMASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNA AVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAF TAAYSELESTLSGVNVVIETYFADVPAEAYKTLTSLKGVTGFGFDLV | |||
Physicochemical properties | |||
Number of amino acids: | 287 | ||
Molecular weight: | 31,656.671 | ||
Theoretical pI: | 5.626 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
Instability index: | 27.741 | ||
aromaticity | 0.125 | ||
GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.230 | ||
sheet | 0.279 |