Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646656.1 | 3prime_partial | 208 | 65-688(+) |
Amino Acid sequence : | |||
MAVLQLWETLKDAITAYTGLSPATFFTLLVLLLATYYVISGLFGSSAPPPRHREYEEESEPLPPPVQLGEITEEELRVYDGSDPKRPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDA SRALAKMSFEEKDLTGDISGLGPFELDALQDWEYKFMGKYVKVGTIKKTVPVSDGSAAPGDSSEAAEGDAAKPAEGGPSETTVVEDAA | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 10,198.266 | ||
Theoretical pI: | 5.048 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 67.676 | ||
aromaticity | 0.049 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.427 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646656.1 | 5prime_partial | 103 | 690-379(-) |
Amino Acid sequence : | |||
PAASSTTVVSDGPPSAGLAASPSAASEESPGAADPSDTGTVFLIVPTLTYLPINLYSQSCKASSSNGPRPEISPVKSFSSKDILARALLASLPANKAYGPPGP* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,198.266 | ||
Theoretical pI: | 5.048 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 67.676 | ||
aromaticity | 0.049 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.427 | ||
sheet | 0.262 |