Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646662.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
NKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGN EVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYAL | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 24,322.736 | ||
Theoretical pI: | 9.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23380 | ||
Instability index: | 51.552 | ||
aromaticity | 0.091 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.291 | ||
sheet | 0.205 |