Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646671.1 | 3prime_partial | 199 | 188-784(+) |
Amino Acid sequence : | |||
MLSPLDFILILRELGNRGSNLTEEELETHTISAWKEGKLHLDRQIGGQGRASSRSLIDAGPFDSMKEVATRILQNKVATIPIIHSSSQDGSFPQLLHLASLSGILRCICRHFRHSSSSLP ILQQPICSIPLGTWVPRIGDSSGQPLAILRPSSSLSSALTLLLQAQVSSIPIVDDNDSLLDIYSRSDITALAKDKVYAQ | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 10,675.608 | ||
Theoretical pI: | 9.329 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
Instability index: | 46.616 | ||
aromaticity | 0.061 | ||
GRAVY | 0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.323 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646671.1 | complete | 99 | 426-127(-) |
Amino Acid sequence : | |||
MVATLFCKILVATSFIESKGPASIRLLEDALPCPPICLSRCNFPSFQADMVCVSSSSSVKFEPRFPSSLKIKMKSRGLSIPINCPLQKSHRGATGIPCS* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,675.608 | ||
Theoretical pI: | 9.329 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
Instability index: | 46.616 | ||
aromaticity | 0.061 | ||
GRAVY | 0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.323 | ||
sheet | 0.212 |