Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646682.1	internal	243	2-730(+)
Amino Acid sequence :
LFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLP AMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAG GGG
Physicochemical properties
Number of amino acids:		243
Molecular weight:		26,893.350
Theoretical pI:		8.970
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26360 26360
Instability index:		46.870
aromaticity		0.103
GRAVY		-0.091
Secondary Structure Fraction
Helix		0.358
turn		0.300
sheet		0.202