Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646688.1 | 3prime_partial | 249 | 3-749(+) |
Amino Acid sequence : | |||
MACHARISTPTAQLGLPELQLGLIPGFGGTQRLPRLVGISKALEMMLMSKPVKGEEAHAIGLVDALVSRDELVSVARRWALEILERRKPWVPTLHKTDKLEPLGEAREIFKFVRVQAKRQ APNLSHPLVCIDVIEEGVVSGPYAGLQKEVDEFQKLLQSDTCKSLVHIFFAQRGTTKVPGITDLGLAPRSIKKVAILGGGLMGSGIATALILSNYPVILKEVNEKFLQAGLDRVKANLQS RVKKGRMTQ | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 27,237.791 | ||
Theoretical pI: | 9.734 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 47.192 | ||
aromaticity | 0.044 | ||
GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.213 | ||
sheet | 0.301 |