Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646690.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
KTSIFFILSLFLILVFSILLALPGSIAKDESFLQCLSAHSSQPPMPIYTPNTSDYSSILQSTIQNLRFSTPTTPKPHLIITPLHESHVQAAVICCKKHGMRVKIRSQGHDFEGLSYTSYV PFVILDLFNFKSISVDVEAGTAWVQVGATIGQLYYTIAERSPTHAFPAGVCPTVGVGGQFSGGGYGYLLRKYGLAADNIIDALIVNADGKILNREQMGEDLFWAIRGGGGASFGVILEWK IKLVPVPSTVTVFTVPRTLEQGATAIVHKW | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 29,358.635 | ||
Theoretical pI: | 8.338 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35660 | ||
Instability index: | 34.139 | ||
aromaticity | 0.104 | ||
GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.256 | ||
sheet | 0.211 |