Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646703.1 | internal | 270 | 3-812(+) |
Amino Acid sequence : | |||
TIGFNWGAAGVSTSVWRGVRLVDVLKRCGIYSRRMGASFVCFEGAENLPGGGGSKYGTSVFREYAMDPSRDIILAYMQNGELLSPDHGFPVRIIIPGFIGGRMVKWLSRIIVTPQESQSH YHFKDNRVLPSHVDAELANSEAWWYKPEYIINELNTNSVITTPSHDEILPINSATTQRPYTLRGYAYSGGGKKVTRVEVTMDGGDTWQVCELDHPEKPNKYGKYWCWCFWSLEVEVLDLL GAKEIAVRAWDQTLNTQPEKLIWNVMGMMN | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 30,504.401 | ||
Theoretical pI: | 6.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 78380 78630 | ||
Instability index: | 30.508 | ||
aromaticity | 0.115 | ||
GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.263 | ||
sheet | 0.215 |