Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646704.1 | 3prime_partial | 242 | 78-803(+) |
Amino Acid sequence : | |||
MVRSDLFITVPTFFRCPISLDVMKSPVSLCTGVTYDRSSIQKWLDNGNNTCPATMQVLQSKDFVPNHTLHRLIQIWSDSMRNNNNNSSSDSGAVSPASGAASSPTAATTTTTTRSISRDQ ARVLVENVRNTNDNCRFNSLRSLANFAEVSEDNRKFLAKIDGFPPTLLGIVAGSNVDSKIEVIEQAVRVLDLILSDCGDKELVKLLDRKQEFLASVLLVLQKGNLDSRIASARVLEIIAA DS | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 13,466.555 | ||
Theoretical pI: | 10.588 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 56.820 | ||
aromaticity | 0.074 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.254 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646704.1 | 5prime_partial | 122 | 802-434(-) |
Amino Acid sequence : | |||
ESAAMISKTLADAILESKFPFCKTKRTEAKNSCFLSNNLTNSLSPQSLRIRSKTLTACSITSIFESTLLPATIPRSVGGKPSIFARNFRLSSETSAKLARLRKELKRQLSFVFLTFSTKT LA* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,466.555 | ||
Theoretical pI: | 10.588 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 56.820 | ||
aromaticity | 0.074 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.254 | ||
sheet | 0.279 |