Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646706.1 | 3prime_partial | 162 | 317-802(+) |
Amino Acid sequence : | |||
MAFCKQEDFGGGHPDPNLTYAKELVTRMGLNKENPQDNPPEFGAAADGDADRNMILGKRFFVTPSDSVAIIAANAVQAIPYFSAGLKGVARSMPTSAALDVVAKHLNLKFFEVPTGWKFF GNLMDAGLCSICGEESFGTGSDHIREKDGIWAVLAWLSILAF | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,443.688 | ||
Theoretical pI: | 5.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 34.366 | ||
aromaticity | 0.105 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.259 | ||
sheet | 0.284 |