Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646708.1	5prime_partial	267	3-806(+)
Amino Acid sequence :
VAELEGEMVGLCFSLAGHGPCIEFAKRLVEVQCKLKEMGESFKVVLIPLDDDEDSFRQTLEETQWLALPLNDALCSKLVRYFELSALPTLVIIGPDGKTRHTNVAELVEEHGAEAYPFTP EKIAELEEIAKKKKESQTLESILILGDRDFVIQKDGSRVQVSELVGKNILLYFSAHWCPPCRAFLPKLIQAYHDIKAKDEKFEVIFISSDRDKESFNDFFSGMPWLALPFGDVRKKFLSR AFKVSGIPTVIAIGSNGRTVTDEARIF*
Physicochemical properties
Number of amino acids:		267
Molecular weight:		10,839.544
Theoretical pI:		10.113
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		44.988
aromaticity		0.051
GRAVY		-0.207
Secondary Structure Fraction
Helix		0.253
turn		0.303
sheet		0.283

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646708.1	complete	99	814-515(-)
Amino Acid sequence :
MSHQKILASSVTVRPLDPMAITVGMPLTLNARLKNFFLTSPKGSANHGMPEKKSLNDSLSRSLEMKITSNFSSLALISWYACINLGRKARHGGHQCAEK*
Physicochemical properties
Number of amino acids:		99
Molecular weight:		10,839.544
Theoretical pI:		10.113
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		44.988
aromaticity		0.051
GRAVY		-0.207
Secondary Structure Fraction
Helix		0.253
turn		0.303
sheet		0.283