Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646719.1 | 3prime_partial | 225 | 90-764(+) |
Amino Acid sequence : | |||
MGNLLCCVQVDQSTVAIKERFGKFNEVLEPGCHCLPWIFGCQLAGHLSLRLQQLDVRCETKTKDNVFVNVVASVQYRALADKASDAFYKLSNTRTQIQAYVFDVIRASVPKLNLDDAFEQ KNEIAKAVEEELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRVAANEKAEAEKILQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFSVNV | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 25,078.418 | ||
Theoretical pI: | 5.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 31.297 | ||
aromaticity | 0.067 | ||
GRAVY | -0.153 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.164 | ||
sheet | 0.311 |