Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646744.1 | internal | 266 | 2-799(+) |
Amino Acid sequence : | |||
VNYVKGYGKFLPPSEVSVDTLEGSNTVVKGKNIIIATGSDVKSLPGVTIDEKKIVSSTGALSLSEIPKKLVVIGAGYIGLEMGSVWGRLGSEVTVVEFAPDIVPSMDGELRKQFQRSLEK QKMKFMLKTKVVGVDTSGEGVKLTLEPAAGGEQTTLEADVVLVSAGRIPFTAGLGLEKIGVETDKIGRIIVDERFASNVPGVYAIGDVIPGPMLAHKAEEDGVACVEFIAGKEGHVDYDM VPGVVYTHPEVASVGKTEEQVKTLGV | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 11,978.550 | ||
Theoretical pI: | 8.709 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 86.458 | ||
aromaticity | 0.053 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.398 | ||
sheet | 0.186 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646744.1 | complete | 113 | 570-229(-) |
Amino Acid sequence : | |||
MILPILSVSTPIFSSPSPAVNGILPAETRTTSASSVVCSPPAAGSRVSFTPSPDVSTPTTLVLSMNFIFCFSRERWNCLRSSPSMDGTMSGANSTTVTSEPRRPQTEPISRPM* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 11,978.550 | ||
Theoretical pI: | 8.709 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 86.458 | ||
aromaticity | 0.053 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.398 | ||
sheet | 0.186 |