Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646757.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
RTSVFGDDVVIVAAYRTPICKSKRGGFKDTFADDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGA GLESMTLNQVAWDTTVNPKAQTLQKAQDCLLPMGITSENVAQRYGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPVATKLVDPKTGDEKPIVVSVDDGIRPSTNLKDLAKLKPAFKKD GTTTAGNASQVSDGAGAVLLMKRSLAM | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 28,112.789 | ||
Theoretical pI: | 8.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 27.072 | ||
aromaticity | 0.049 | ||
GRAVY | -0.096 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.213 | ||
sheet | 0.255 |