Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646760.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGLEIVV | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 29,180.079 | ||
Theoretical pI: | 8.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.675 | ||
aromaticity | 0.098 | ||
GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.294 | ||
sheet | 0.215 |