Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646762.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
VMAMQRSKSTIQPPTYGNLITILSIDGGGVRGVIPATILAYLESQLQELDGKDARIADYFDVIAGTSTGGLVTTMLTTPDDDNRPLFTANDVKDFYLNSCPKIFPQYRGPFASVRNAIKA ISGPKYSGRHLRELVKETLGEARLRHTLTNVVIPTFDIQKLQPTIFSSYEVKKNESLDAKLSDICISTSAAPTFLPAYHFKNEYSDGKVREFNLIDGCIAANNPALIAISEVTKQVLKGN PDFFPIKAT | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 12,432.048 | ||
Theoretical pI: | 5.066 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 49.420 | ||
aromaticity | 0.100 | ||
GRAVY | 0.034 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.236 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646762.1 | 5prime_partial | 110 | 749-417(-) |
Amino Acid sequence : | |||
CGLYGEEVRVALQNLLCNFTDGNQSRIIRSDTAINEIELSHFPIRILIFEVIGRQKGWCCGSAYADVREFSIQAFILLYLIAREDGGLEFLDVKSGNNHICQSMSEPRFS* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,432.048 | ||
Theoretical pI: | 5.066 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 49.420 | ||
aromaticity | 0.100 | ||
GRAVY | 0.034 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.236 | ||
sheet | 0.245 |