Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646769.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
HVNFFLAFFFVFIFLCCSSPSYSASTRCHPDDYKVLMQIKQSLHNPYHLASWVPNTDCCDWYALECSITTNRVNVLKIFSGQISGQIPDAVGDLPFLETLLFRKLTNLTGSIPRSVTKLK NLKSLVLSWNTLSGPIPSFLGEIKTLKLIDLSFNQFSGSIPPSLSDLPNLESLHLDRNRLTGPIPESFGRFSGSLKYLVLSHNQLSGRIPATLRNVDLDTIDLSRNTLEGDASMLFGEEK SLRDVDLSRNVLEFDMSTLRFP | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 11,899.100 | ||
Theoretical pI: | 11.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 85.218 | ||
aromaticity | 0.028 | ||
GRAVY | -0.997 | ||
Secondary Structure Fraction | |||
Helix | 0.138 | ||
turn | 0.349 | ||
sheet | 0.156 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646769.1 | 5prime_partial | 176 | 787-257(-) |
Amino Acid sequence : | |||
GNLSVDISNSKTFLDRSTSLSDFSSPNSIDASPSNVFLDRSIVSKSTFLSVAGIRPESWLCDSTRYFRDPENRPKDSGIGPVRRLRSRWRDSRFGRSEREGGMEPENWLNERSMSFRVLI SPRKEGIGPLRVFQLSTRDLRFLSLVTERGIEPVRLVSLRKSRVSRKGRSPTASGI* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 11,899.100 | ||
Theoretical pI: | 11.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 85.218 | ||
aromaticity | 0.028 | ||
GRAVY | -0.997 | ||
Secondary Structure Fraction | |||
Helix | 0.138 | ||
turn | 0.349 | ||
sheet | 0.156 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646769.1 | 5prime_partial | 110 | 788-456(-) |
Amino Acid sequence : | |||
RKPQRRHIEFQDVSRQIYVPQRFLLSEQHRCVSLQRVPRQIDRVQVHVPQRRGDPTGELVVRQHEVLQGSGEPTEGFWDWSGQTVAIEVEGFEVRKIGERGRDGAGELVE* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,899.100 | ||
Theoretical pI: | 11.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 85.218 | ||
aromaticity | 0.028 | ||
GRAVY | -0.997 | ||
Secondary Structure Fraction | |||
Helix | 0.138 | ||
turn | 0.349 | ||
sheet | 0.156 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646769.1 | 5prime_partial | 109 | 789-460(-) |
Amino Acid sequence : | |||
SETSASTYRIPRRFSTDLRPSAISPLRTASMRLPPTCSSTDRSCPSPRSSASRGSDRRAGCATARGTSGIRRTDRRILGLVRSDGCDRGGGIRGSEDRREREGWSRRIG* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,899.100 | ||
Theoretical pI: | 11.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 85.218 | ||
aromaticity | 0.028 | ||
GRAVY | -0.997 | ||
Secondary Structure Fraction | |||
Helix | 0.138 | ||
turn | 0.349 | ||
sheet | 0.156 |