Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646786.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
GIVHYNGFRSSSSSSPLMPDMPISNASTPIVHRFYSNLTGLTTGPFWVPVPRDVDERMFITVGVGAEPCGSDINCTTSPFGPRHRLSANMNNISFVIPANSSRSMLEAFHFNVSGVYTED FPDQPAIQFDYTDPALGNAPIATMVAPKQTSVKRLKYNATVEIVLQNTAVLTIENHPIHLHGFNFHVLAQGFGNYNAQTDRSKFNLVDPQERNTIGVPAGGWAVIRFRANNPGVWFMHCH LDVHLPWG | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 12,562.394 | ||
Theoretical pI: | 9.254 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 47.767 | ||
aromaticity | 0.071 | ||
GRAVY | -0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.304 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646786.1 | 5prime_partial | 112 | 746-408(-) |
Amino Acid sequence : | |||
APRQMDVQVAVHEPYTRIIGPESDNSPTSGGHANGVPFLRVNQVELAPVSLGIIIPEPLSQNMKIKSMKMNWVVLNRKHSRVLQHYLYCSIVLEPLYASLLWSNHRSYGSIA* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,562.394 | ||
Theoretical pI: | 9.254 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 47.767 | ||
aromaticity | 0.071 | ||
GRAVY | -0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.304 | ||
sheet | 0.232 |