Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646787.1 | 5prime_partial | 249 | 3-752(+) |
Amino Acid sequence : | |||
EFARQENLKIISIADLIRYRRKREKLVERSAAAPIPTMWGPFKAYCYKSVLDGIEHIAMVKGEIGDGQDILVRVHSECLTGDIFGSARCDCGNQLALAMEQIEAAGRGVLVYLRGHEGRG IGLGHKLRAYNLQDDGCDTVEANEELGLPVDSREYGIGAQILRDLGVRTMKLMTNNPAKYIGLKGYGLSVAGRVPLLSLITKENKRYLETKRTKMGHIYGAAYNGHLNGLFDGNGAAAAK NPSQDSSEE* | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 24,570.107 | ||
Theoretical pI: | 8.225 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 51045 | ||
Instability index: | 66.889 | ||
aromaticity | 0.108 | ||
GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.226 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646787.1 | 5prime_partial | 212 | 819-181(-) |
Amino Acid sequence : | |||
PVSFGKHAIKFYLPLLFVAKLWFIPQMNLEKDFWLLLRHFHRKDHLDVHCKQHHKYAPFLYVSSPNISCSPWLSDLAMEPCLQLKVHNLSDQCTWQGCLSSTSLCGHQDHVISAHRCHTP LNQQAIPAPHWLPQYHNHHLAGCMHEACDPNQYLYLHVHVGTPVRPSQLLQFAPWQVPAGYHSHIWLNQICPLLSIQSALSQEYLVRPQSHL* | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 24,570.107 | ||
Theoretical pI: | 8.225 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 51045 | ||
Instability index: | 66.889 | ||
aromaticity | 0.108 | ||
GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.226 | ||
sheet | 0.231 |