Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646797.1 | 3prime_partial | 258 | 42-815(+) |
Amino Acid sequence : | |||
MYRCAASRLRPLKSRGGNRFSSTSSVATRPPSSGGFFSWLTGERSSTLPPLDFALPGVATAPSLPDFVEPGKTKITTLPNGLKIASETSANPAASIGLYVDCGSVYESPISCGASHLLER MAFKSTTNRSHLRIVREVEAIGGNVMASASREQMAYTYDALKTYVPEMLEVLIDCVRNPVFLDWEVKEQLQKVKAEIAEANNNPQGLIMEAVHSAGYAGALANPLLAPESAINRLDATIL EEFVAENYTAPRMVLAAS | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 10,508.021 | ||
Theoretical pI: | 9.804 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 55.551 | ||
aromaticity | 0.040 | ||
GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.310 | ||
sheet | 0.320 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646797.1 | complete | 100 | 328-26(-) |
Amino Acid sequence : | |||
MEAAGFADVSEAILRPFGKVVILVFPGSTKSGSEGAVATPGRAKSSGGRVLDRSPVSQLKNPPEEGGRVATELVLENLLPPRLLRGLSREAAHLYMIGRV* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,508.021 | ||
Theoretical pI: | 9.804 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 55.551 | ||
aromaticity | 0.040 | ||
GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.310 | ||
sheet | 0.320 |