Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646797.1	3prime_partial	258	42-815(+)
Amino Acid sequence :
MYRCAASRLRPLKSRGGNRFSSTSSVATRPPSSGGFFSWLTGERSSTLPPLDFALPGVATAPSLPDFVEPGKTKITTLPNGLKIASETSANPAASIGLYVDCGSVYESPISCGASHLLER MAFKSTTNRSHLRIVREVEAIGGNVMASASREQMAYTYDALKTYVPEMLEVLIDCVRNPVFLDWEVKEQLQKVKAEIAEANNNPQGLIMEAVHSAGYAGALANPLLAPESAINRLDATIL EEFVAENYTAPRMVLAAS
Physicochemical properties
Number of amino acids:		258
Molecular weight:		10,508.021
Theoretical pI:		9.804
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		55.551
aromaticity		0.040
GRAVY		-0.017
Secondary Structure Fraction
Helix		0.290
turn		0.310
sheet		0.320

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646797.1	complete	100	328-26(-)
Amino Acid sequence :
MEAAGFADVSEAILRPFGKVVILVFPGSTKSGSEGAVATPGRAKSSGGRVLDRSPVSQLKNPPEEGGRVATELVLENLLPPRLLRGLSREAAHLYMIGRV*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		10,508.021
Theoretical pI:		9.804
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		55.551
aromaticity		0.040
GRAVY		-0.017
Secondary Structure Fraction
Helix		0.290
turn		0.310
sheet		0.320