Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646801.1 | internal | 248 | 1-744(+) |
Amino Acid sequence : | |||
LQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPI INFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKRPGRPIET YIFAMFNE | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 27,411.675 | ||
Theoretical pI: | 8.084 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30370 | ||
Instability index: | 43.222 | ||
aromaticity | 0.105 | ||
GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.315 | ||
sheet | 0.198 |