Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646801.1	internal	248	1-744(+)
Amino Acid sequence :
LQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPI INFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKRPGRPIET YIFAMFNE
Physicochemical properties
Number of amino acids:		248
Molecular weight:		27,411.675
Theoretical pI:		8.084
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30370 30370
Instability index:		43.222
aromaticity		0.105
GRAVY		-0.168
Secondary Structure Fraction
Helix		0.343
turn		0.315
sheet		0.198