Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646803.1 | internal | 148 | 1-444(+) |
Amino Acid sequence : | |||
GRPFWRLVVSEATGCTNSDYFEEVYEFFANGDAWRLPAGAQETMCLLKDAGVKLAVVSNFDTRLRKLLKDLNVTDLFDAIIVSSEVGHEKPDPQIFKAALDGLGVEAGKAVHVGDDIQAD KDGANAVGIDCWLWGSEVKTFADIGDRI | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 11,422.957 | ||
Theoretical pI: | 10.437 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 89.025 | ||
aromaticity | 0.046 | ||
GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.343 | ||
sheet | 0.213 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646803.1 | 5prime_partial | 108 | 446-120(-) |
Amino Acid sequence : | |||
RMRSPISAKVFTSDPQSQQSIPTALAPSLSACMSSPTCTALPASTPNPSKAALKICGSGFSCPTSDDTIMASNRSVTLRSFNSFLRRVSKLETTASLTPASFRRHIVS* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,422.957 | ||
Theoretical pI: | 10.437 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 89.025 | ||
aromaticity | 0.046 | ||
GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.343 | ||
sheet | 0.213 |