Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646814.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
NFFLAFFFVFIFLCCSSPSYSASTRCHPDDYKVLMQIKQSLHNPYHLASWVPNTDCCDWYALECSITTNRVNVLKIFSGQISGQIPDAVGDLPFLETLLFRKLTNLTGSIPRSVTKLKNL KSLVLSWNTLSGPIPSFLGEIKTLKLIDLSFNQFSGSIPPSLSDLPNLESLHLDRNRLTGPIPESFGRFSGSLKYLVLSHNQLSGRIPATLRNVDLDTIDLSRNTLEGDASMLFGEEKSL RDVDLSRNVLEFDMSTL | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 11,581.805 | ||
Theoretical pI: | 11.701 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 85.530 | ||
aromaticity | 0.028 | ||
GRAVY | -0.978 | ||
Secondary Structure Fraction | |||
Helix | 0.142 | ||
turn | 0.349 | ||
sheet | 0.151 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646814.1 | 5prime_partial | 174 | 774-250(-) |
Amino Acid sequence : | |||
LSVDISNSKTFLDRSTSLSDFSSPNSIDASPSNVFLDRSIVSKSTFLSVAGIRPESWLCDSTRYFRDPENRPKDSGIGPVRRLRSRWRDSRFGRSEREGGMEPENWLNERSMSFRVLISP RKEGIGPLRVFQLSTRDLRFLSLVTERGIEPVRLVSLRKSRVSRKGRSPTASGI* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 11,581.805 | ||
Theoretical pI: | 11.701 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 85.530 | ||
aromaticity | 0.028 | ||
GRAVY | -0.978 | ||
Secondary Structure Fraction | |||
Helix | 0.142 | ||
turn | 0.349 | ||
sheet | 0.151 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646814.1 | 5prime_partial | 107 | 772-449(-) |
Amino Acid sequence : | |||
QRRHIEFQDVSRQIYVPQRFLLSEQHRCVSLQRVPRQIDRVQVHVPQRRGDPTGELVVRQHEVLQGSGEPTEGFWDWSGQTVAIEVEGFEVRKIGERGRDGAGELVE* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,581.805 | ||
Theoretical pI: | 11.701 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 85.530 | ||
aromaticity | 0.028 | ||
GRAVY | -0.978 | ||
Secondary Structure Fraction | |||
Helix | 0.142 | ||
turn | 0.349 | ||
sheet | 0.151 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646814.1 | 5prime_partial | 106 | 773-453(-) |
Amino Acid sequence : | |||
SASTYRIPRRFSTDLRPSAISPLRTASMRLPPTCSSTDRSCPSPRSSASRGSDRRAGCATARGTSGIRRTDRRILGLVRSDGCDRGGGIRGSEDRREREGWSRRIG* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,581.805 | ||
Theoretical pI: | 11.701 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 85.530 | ||
aromaticity | 0.028 | ||
GRAVY | -0.978 | ||
Secondary Structure Fraction | |||
Helix | 0.142 | ||
turn | 0.349 | ||
sheet | 0.151 |