Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646818.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
ALAAYKLSHPVRSYLNRKTDMIMAGGRHPMKITYSVGFKSDGKITGLYLNILINAGMSEDISKVIPHHMIKALKKYNWGALSFDIKLCKTNLPSRSVMRAPGELQGSYVAEAVIEHVASV LSMEVDSIRAKNLHTYESLKLFYGISSGQPNEYTLPMVVDKLSNSSRFDRRFEEIRRFNGCNAWKKRGISWVPIVHEVTLKPTPGKVGILNDGSVVVEVGGIELGQGLWTKVRQMAAFAL GPL | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 10,712.143 | ||
Theoretical pI: | 6.489 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.329 | ||
aromaticity | 0.060 | ||
GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.360 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646818.1 | complete | 114 | 383-39(-) |
Amino Acid sequence : | |||
MESTSMERTDATCSITASATYDPCNSPGARITDLLGRFVLHNLMSKDKAPQLYFFNAFIMWCGMTLLISSDIPALINMLRYRPVIFPSDLKPTLYVIFIGCLPPAIIISVLRFR* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 10,712.143 | ||
Theoretical pI: | 6.489 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.329 | ||
aromaticity | 0.060 | ||
GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.360 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646818.1 | 5prime_partial | 100 | 728-426(-) |
Amino Acid sequence : | |||
SGPSANAAICLTFVQSPWPNSIPPTSTTTDPSLRMPTLPGVGFKVTSCTIGTQEIPRFFHALQPLNRLISSNLRSNLDELDNLSTTIGKVYSLGCPELIP* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,712.143 | ||
Theoretical pI: | 6.489 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.329 | ||
aromaticity | 0.060 | ||
GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.360 | ||
sheet | 0.200 |