Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646823.1 | internal | 144 | 2-433(+) |
Amino Acid sequence : | |||
LIQELSTPPAGSEDIYFPTKYSQTFFTQCMACLWKQYWSYWRNPPYTAVRLFFTTVIALMFGTIFWDLGSKTNSPQDLANAMGSMYAAVLFLGVQNATSVQPVVAIERTVFYRERAAGMY SALPYAFGQVVIEIPYILIQALIY | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,373.795 | ||
Theoretical pI: | 6.365 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38515 | ||
Instability index: | 53.167 | ||
aromaticity | 0.174 | ||
GRAVY | 0.308 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.201 | ||
sheet | 0.257 |