Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646827.1 | 5prime_partial | 205 | 3-620(+) |
Amino Acid sequence : | |||
SFSLARSHSPLVASRFQVRSAMAESGASSPFKKIQIQRENTTFDAYVIGKEDAPGIVVLQEWWGVDFEIKNHAEKISKLGSGYKALIPDLYRGKVGLDAAEAQHLMEGLDWQGAVKDIHA SVNWLKANGSKKVGVTGYCMGGALSIASAVLVSEVDAVVAFYGVPSPLLADPAQAKAPVQAHFGELDNIVGFSDITAAKSLEEKL* | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 21,886.662 | ||
Theoretical pI: | 5.949 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 26.581 | ||
aromaticity | 0.083 | ||
GRAVY | 0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.244 | ||
sheet | 0.288 |