Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646835.1	internal	228	3-686(+)
Amino Acid sequence :
YPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVPAMEMTKWFDTNYHFIVPELGPD TKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYSELESTLSG
Physicochemical properties
Number of amino acids:		228
Molecular weight:		11,967.025
Theoretical pI:		9.587
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27500 27625
Instability index:		45.742
aromaticity		0.098
GRAVY		-0.011
Secondary Structure Fraction
Helix		0.373
turn		0.186
sheet		0.294

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646835.1	5prime_partial	102	1-309(+)
Amino Acid sequence :
DTLARDQKESSNLHWNLSGMEKAVLKIWRRFRQTLGHPSGNKWRMLELSIFPAILFLTMTRCLTQQQCLVLFLLDTIGLVVRLDLTPISPWQEGMPQFLLWK*
Physicochemical properties
Number of amino acids:		102
Molecular weight:		11,967.025
Theoretical pI:		9.587
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27500 27625
Instability index:		45.742
aromaticity		0.098
GRAVY		-0.011
Secondary Structure Fraction
Helix		0.373
turn		0.186
sheet		0.294