Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646838.1 | internal | 202 | 3-608(+) |
Amino Acid sequence : | |||
VEPSNSNTAMADEEQEVKLLGLWASPYVRRVEWALKLKGIGYEYMEEDLQNKSSLLLKYNPVYKKVPVLVHGGQPIAESLIILEYIEETWRHHPLLPDDPYAKATGRFWAKFINERLLEH FMAALLFTEGEEQEKEAKEVGIALEIIEGQLNKENKFLMGGEIRCGYLDLALGWLPHWSKAAEEVTGIRMFDSANYPFISEW | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 23,257.334 | ||
Theoretical pI: | 4.933 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51910 51910 | ||
Instability index: | 47.982 | ||
aromaticity | 0.114 | ||
GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.203 | ||
sheet | 0.361 |