Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646843.1 | internal | 219 | 1-657(+) |
Amino Acid sequence : | |||
LSSNNSNIKTQQCLSNLHIPAAHQKVSAALVLDHEKHRNQSSSTNNHSFLESISNLLHLDSKDSHNRHHHSHQFIDWNSTPILSPKEEISEQWQEILASSSDFDNIINPVLEPWLRREII KYGEFAQATYDGFDFDSHSEYCGSCRYSSQKLFDKLGLTHHGYSVSKYIYAMSHIDVPKWLERSHLVDTWSKDSNWMGYIAVSDDSESRRLGRRDIVIA | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 25,249.587 | ||
Theoretical pI: | 6.126 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45045 | ||
Instability index: | 63.579 | ||
aromaticity | 0.096 | ||
GRAVY | -0.671 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.274 | ||
sheet | 0.196 |