Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646844.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
SDYLPWLSYFYDPARIKQRCAALVPRVRTLVRGIIEEHRAVHGGSGSGDNGYELTDESDFVDVLLSLDGEGKLNEEDMISILWEMIFRGTDTMGILTEWIMAELILNPNIQAKLQNELDS VVANNHDITDAVVTNLPYLQAVVKETLRVHPPGPLLSWARLSTSDVKLGNGMLIPSNTTAMVNMWAITH | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 21,060.798 | ||
Theoretical pI: | 4.745 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 34950 | ||
Instability index: | 27.095 | ||
aromaticity | 0.069 | ||
GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.238 | ||
sheet | 0.286 |