Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646846.1 | internal | 175 | 2-526(+) |
Amino Acid sequence : | |||
LTRPTITDTMASGIVQEVLPPVLDSTSEPPPLFDGTTRLYTSFICPYAQRVWITRNYKGLQDEIKLVPLDLGNRPSWYKEKVYPGNKVPALEHNNEVKGESLDLIKYIDANFEGPSLLPD DPTKREFAEELFAYTDKFSGGVFGSLKGDGDMGAPFDHLESALQKFSDGPFFLGQ | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 19,506.741 | ||
Theoretical pI: | 4.687 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 40.861 | ||
aromaticity | 0.114 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.274 | ||
sheet | 0.234 |