Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646860.1 | 3prime_partial | 121 | 56-418(+) |
Amino Acid sequence : | |||
MPIESSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVIMYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT I | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,430.149 | ||
Theoretical pI: | 5.169 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 65.671 | ||
aromaticity | 0.050 | ||
GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.231 | ||
sheet | 0.298 |