Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646866.1 | 5prime_partial | 146 | 3-443(+) |
Amino Acid sequence : | |||
RRGLRGGIVAMAAPGSVQKSEEEWRMVLSPEQFRILRQKGTELPGTGEYDKFYEDGIYSCAGCGTPLYKSTTKFNSGCGWPAFFEGLPGAIVRTPDPDGRRTEITCAACGGHLGHVFKGE GFRTPTNERHCVNSVSIKFIPATPAS* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,829.768 | ||
Theoretical pI: | 8.587 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 45.725 | ||
aromaticity | 0.096 | ||
GRAVY | -0.416 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.295 | ||
sheet | 0.205 |