Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646881.1	internal	157	1-471(+)
Amino Acid sequence :
ARLEEAFGAPVLEAYAMTEASHLMASNPLPENGSHKPGSVGRPVGQEMAILDENGVEQPAQVSGEVCIRGPNVTKGYKNNPDANKEAFRFGWFHTGDLGFLDSDGYLHLVGRIKELINRG GEKISPIEVDAVLLSHPDVAQAVAFGVPDDKYGEEIN
Physicochemical properties
Number of amino acids:		157
Molecular weight:		16,868.632
Theoretical pI:		4.775
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		29.597
aromaticity		0.070
GRAVY		-0.354
Secondary Structure Fraction
Helix		0.274
turn		0.293
sheet		0.287