Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646882.1 | internal | 183 | 3-551(+) |
Amino Acid sequence : | |||
QAIGSVLVIRFEMPNPSSNLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPLFGFHDPESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCIIDG GNEWYQNTERREQAMAELGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKHIEDILLKVAAQV | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 19,918.671 | ||
Theoretical pI: | 5.670 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 39.854 | ||
aromaticity | 0.066 | ||
GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.262 | ||
sheet | 0.290 |