Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646892.1 | internal | 195 | 2-586(+) |
Amino Acid sequence : | |||
RNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPN PEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKR | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,491.049 | ||
Theoretical pI: | 9.127 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23380 | ||
Instability index: | 38.158 | ||
aromaticity | 0.108 | ||
GRAVY | -0.155 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.313 | ||
sheet | 0.185 |