Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646892.1	internal	195	2-586(+)
Amino Acid sequence :
RNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPN PEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKR
Physicochemical properties
Number of amino acids:		195
Molecular weight:		21,491.049
Theoretical pI:		9.127
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23380 23380
Instability index:		38.158
aromaticity		0.108
GRAVY		-0.155
Secondary Structure Fraction
Helix		0.344
turn		0.313
sheet		0.185