Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646893.1 | 3prime_partial | 158 | 9-482(+) |
Amino Acid sequence : | |||
MAADESVQVVQGDNYRSHIYGEGEKDTVWRLGAPPNYDVVNKLFEEGRTQVWSEDSMEGKVQRLVKTWEMEIVHKIRPQDFKTINAEKYRFSLNGEPPVTLDSLIKIGSYNAFLATSMPE NFRGYNPAAETAESANKKFTTIFPRGFALEILQVYSGP | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 17,941.957 | ||
Theoretical pI: | 5.278 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 33.887 | ||
aromaticity | 0.114 | ||
GRAVY | -0.541 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.247 | ||
sheet | 0.247 |