Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646909.1 | internal | 210 | 2-631(+) |
Amino Acid sequence : | |||
SIPKDESFLQCLSAHSSQPPMPIYNPNTSDYSSILQSTIQNLRFSTPTTPKPHLIITPLHESHVQAAVICCKKHGMQMKIRSQGHDFEGLSYTSYVPFVILDLFNFKSISVDVEAGTAWV QVGATIGQLYYTIAERSRTHAFQAGVCPSVGVGGQFSGGGYGYLLRKYGLAADNIIDALIVNADGKILNREQMGEDLFWAIRGGGGASFG | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 22,789.620 | ||
Theoretical pI: | 6.628 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24660 | ||
Instability index: | 31.495 | ||
aromaticity | 0.100 | ||
GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.286 | ||
sheet | 0.200 |