Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646910.1 | internal | 180 | 3-542(+) |
Amino Acid sequence : | |||
SSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPTIQEE LDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKA | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 20,134.831 | ||
Theoretical pI: | 6.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 11920 | ||
Instability index: | 51.844 | ||
aromaticity | 0.078 | ||
GRAVY | -0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.228 | ||
sheet | 0.278 |