Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646913.1 | 3prime_partial | 164 | 75-566(+) |
Amino Acid sequence : | |||
MMVSHLEWRMVSLAILLLLVPRFPATSQVHLANEKRVKSAVFLSPMFVLGPGSVENKYYYNIGFPRGHIFLKEFDAEVIDEEGNPVPLHETYLHHWVVERYYALRDVDISKERGDRKLNR PKILSARNSGVCDDNTLGQYFGLGSETRKTATYVPDPYGIEVGN | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,726.206 | ||
Theoretical pI: | 6.591 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
Instability index: | 35.298 | ||
aromaticity | 0.110 | ||
GRAVY | -0.268 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.244 | ||
sheet | 0.250 |